PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G167100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 286aa    MW: 31889.8 Da    PI: 5.1029
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G167100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.63e-50161411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelv +yL+++++g   ++  +i+evd+y+++Pw+Lp+++  + +ewyfF++r +ky++g+r+nra+ +gyWkatg dk+
  Brast06G167100.1.p  16 LPPGFRFHPTDEELVAHYLCARAAGLGAPA-PIIAEVDLYRFDPWELPSMALFGAREWYFFTPRGRKYPNGSRPNRAAGNGYWKATGADKP 105
                         79*************************999.88***************76667899*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v + kg++ g+kk Lvfy+g+ p+g+ktdW+mheyrl
  Brast06G167100.1.p 106 VAH-KGSTAGIKKALVFYHGKPPRGVKTDWIMHEYRL 141
                         ***.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-6212174IPR003441NAC domain
PROSITE profilePS5100558.41416174IPR003441NAC domain
PfamPF023655.3E-2617141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MVTTAGRRDA EAELNLPPGF RFHPTDEELV AHYLCARAAG LGAPAPIIAE VDLYRFDPWE  60
LPSMALFGAR EWYFFTPRGR KYPNGSRPNR AAGNGYWKAT GADKPVAHKG STAGIKKALV  120
FYHGKPPRGV KTDWIMHEYR LADSNSRSSS SRKKKDGSGT LRLDDWVLCR LYNKKNEWEK  180
MQQQKEQDKA AMAAASWGET RTPESEIDND DPFPELADSI PACTADAILP KEEVQELELD  240
NDWLMGINLD DLQGPASMLP WDDSYAASFL SPVAAKTEQD MSLFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-9481807174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0108291e-141AJ010829.1 Triticum sp. mRNA for GRAB1 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557366.10.0PREDICTED: NAC domain-containing protein 67-like
SwissprotQ7EZT11e-128NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLI1H2K00.0I1H2K0_BRADI; Uncharacterized protein
STRINGBRADI1G53770.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.13e-74NAC family protein